PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P15080_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 598aa    MW: 67391.1 Da    PI: 6.4405
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P15080_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS229.12e-703055231221
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++lL+ cA+av+ +d + a++lL+++++++sp+gd  qRla++f+ +L+arla+++s++y+al +++t+    ++ l+a++l+  ++
  GSMUA_Achr7P15080_001 305 LRTLLILCAQAVAVDDRRTANELLKQIRQHSSPNGDGSQRLAHCFADGLEARLAGMGSQIYQALVAKRTT---ATDILKAYHLYLAAC 389
                            5789*************************************************************99999...9************** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgv 174
                            P+ ++sh+  Nq+Il+ +e++++vHiiDf+i  G+QWp+L+q La+R++gpp+lRiTg++ p++g   +e++eetg+rLa +A+ ++v
  GSMUA_Achr7P15080_001 390 PFKRISHFFSNQTILNLAEKASKVHIIDFGIYFGFQWPCLIQRLATREGGPPKLRITGIDVPQPGfrPTERIEETGQRLAAYAKGFNV 477
                            ****************************************************************9*********************** PP

                   GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsle 221
                            pfe+++ +a+++e++++e+L++ ++E+++Vn+ ++  +l de+v ++
  GSMUA_Achr7P15080_001 478 PFEYQA-IASKWESIRVEDLHIAKDEVVVVNCLYRFRNLIDETVIVD 523
                            ******.7********************************9998665 PP

2GRAS50.92.9e-16523594303374
                   GRAS 303 aerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            ++r+er et+++W+ r  +aGF ++pl+ +++k+a+  ++ ++ + + ++e+s +l++gWk+r  +++SaW+
  GSMUA_Achr7P15080_001 523 DKRVERPETYKQWQVRNLRAGFVQLPLDPDIMKKANDKVKSCYHKDFVIDEDSRWLIQGWKGRITYAISAWK 594
                            579****************************************889*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.194279598IPR005202Transcription factor GRAS
PfamPF035147.0E-68305523IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MVMDSGLREL SGMMSGLSYD DFYSDQNIFR AIGLGESQPF LGHVNYVDLA QMSSLTNQSS  60
YPTSISTSVE GDNPEDSDIF YSDIALNYIS RMLLEEDIDE KVSTYKEDSA LRAAVKPFYD  120
ILGQKYPPSP DRPLRVADNS SVCDSSDYQQ SLTCPGSVDY SPQTPSSSYN SISSIEEPFN  180
NVTISPNLFF GSMPTWHFKR GVEEARKFLP SNDKLFINLE SNGDLDLTEG RNNKQSAVSS  240
DGEVRSEMFD MVLLYQGDKC SKKMSDLREA MQNEASKSAQ NVPTKGSSGG KTRRKKQTKK  300
EVVDLRTLLI LCAQAVAVDD RRTANELLKQ IRQHSSPNGD GSQRLAHCFA DGLEARLAGM  360
GSQIYQALVA KRTTATDILK AYHLYLAACP FKRISHFFSN QTILNLAEKA SKVHIIDFGI  420
YFGFQWPCLI QRLATREGGP PKLRITGIDV PQPGFRPTER IEETGQRLAA YAKGFNVPFE  480
YQAIASKWES IRVEDLHIAK DEVVVVNCLY RFRNLIDETV IVDKRVERPE TYKQWQVRNL  540
RAGFVQLPLD PDIMKKANDK VKSCYHKDFV IDEDSRWLIQ GWKGRITYAI SAWKPTEA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-333095458252GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409514.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809331e-125SCL9_ARATH; Scarecrow-like protein 9
TrEMBLM0THP50.0M0THP5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P15080_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-121GRAS family protein